Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0573700_circ_g.1 |
ID in PlantcircBase | osa_circ_029044 |
Alias | Os05circ19237/Os_ciR455 |
Organism | Oryza sativa |
Position | chr5: 28580408-28580547 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os05g0573700 |
Parent gene annotation |
Similar to Ketol-acid reductoisomerase, chloroplast precursor (E C 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-bet a-hydroxylacil reductoisomerase). (Os05t0573700-01);Similar to K etol-acid reductoisomerase. (Os05t0573700-02) |
Parent gene strand | - |
Alternative splicing | Os05g0573700_circ_g.2 Os05g0573700_circ_g.3 Os05g0573700_circ_g.4 |
Support reads | 24/94/8/36 |
Tissues | leaf and panicle/root/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0573700-01:1 Os05t0573700-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.812500238 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28580526-28580525(+) 28580484-28580451(-) |
Potential amino acid sequence |
MNSSKKNAFFEIVFEIIPVMPSTVFLYAISSSIPCSVYLLNRASTMP*(+) MDEEMAYKNTVEGITGIISKTISKKAFFLELFMASWRLCLGDTQSKEWMKKWHTKTP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |