Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d005127_circ_g.4 |
ID in PlantcircBase | zma_circ_007289 |
Alias | zma_circ_0000819 |
Organism | Zea mays |
Position | chr2: 159755495-159759177 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d005127 |
Parent gene annotation |
E3 ubiquitin-protein ligase UPL1 |
Parent gene strand | + |
Alternative splicing | Zm00001d005127_circ_g.5 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d005127_T009:9 Zm00001d005127_T002:9 Zm00001d005127_T001:9 Zm00001d005127_T006:9 Zm00001d005127_T023:9 Zm00001d005127_T011:9 Zm00001d005127_T012:9 Zm00001d005127_T021:9 Zm00001d005127_T003:9 Zm00001d005127_T014:9 Zm00001d005127_T018:9 Zm00001d005127_T004:9 Zm00001d005127_T008:9 Zm00001d005127_T019:9 Zm00001d005127_T016:9 Zm00001d005127_T024:9 Zm00001d005127_T026:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.060883103 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
159755541-159759057(-) |
Potential amino acid sequence |
MSIFQEVGVLQVVVHLYMSSRKPMTQCTLYNLPRNQSTKAKTFTSFMNGKKQSFF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |