Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0819900_circ_g.1 |
| ID in PlantcircBase | osa_circ_004630 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 34949823-34950366 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0819900 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os01t0819900- 01);Similar to HEAT repeat-containing protein. (Os01t0819900-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0819900_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0819900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.313260754 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34950322-34949854(+) 34950361-34950358(-) |
| Potential amino acid sequence |
MVRTFSLLSKRTHSPPGCFGCATGRF*(+) MSSLTQKGKGSDHGPVSSANASNSQISATSSVTSDNRSSTVAYAPSTSSSLDQTAPASARSSVD GWGEIENDNTQEENGSDKEGWDDVDPFDEKPPPSLLSNIQAAQKRPVAQPKQPGGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |