Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0973600_circ_g.2 |
| ID in PlantcircBase | osa_circ_006033 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 43017845-43018061 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0973600 |
| Parent gene annotation |
Protein of unknown function DUF506, plant family protein. (Os01t 0973600-01);Protein of unknown function DUF506, plant family pro tein. (Os01t0973600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0973600-01:1 Os01t0973600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.194731183 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43017891-43017864(+) 43018009-43017864(+) 43018034-43017983(+) |
| Potential amino acid sequence |
MVHSLLFSIHESDLLAFKRGQCSASCIRHLLVKLLRYSGYDAAVCVSKWQGFDKIPGDLQARRR *(+) MMQLFAYQNGRDSTRYLEIYKQGGDEKENELLSMVHSLLFSIHESDLLAFKRGQCSASCIRHLL VKLLRYSGYDAAVCVSKWQGFDKIPGDLQARRR*(+) MAGIRQDTWRSTSKAAMRKKTSYSPWSTRCYSRSMSQTFWLSKEVNAVPAASVIYL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |