Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d009631_circ_g.1 |
ID in PlantcircBase | zma_circ_009629 |
Alias | Zm08circ00036, AC234185.1_FG004_C1 |
Organism | Zea mays |
Position | chr8: 73930366-73930881 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d009631 |
Parent gene annotation |
CTP synthase family protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d009631_T003:2 Zm00001d009631_T001:2 Zm00001d009631_T009:1 Zm00001d009631_T002:2 Zm00001d009631_T007:2 Zm00001d009631_T008:2 Zm00001d009631_T004:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.206494604 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
73930852-73930409(+) 73930877-73930429(+) 73930854-73930406(-) |
Potential amino acid sequence |
MVPASVLRYGSGISSPWLCCCHEST*(+) MDLVYLPRGYVVVTSQLDVQKSLIVSKVQVHLTTIVQNKHFAVLEWGHGSGIGVEVWIWYIFPV VMLLSRVNLMSRNLS*(+) MSPFEHGEVFVLDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQIHTSTPMPEPCPHSSTAK CLFWTMVVRWTWTLETMRDFWTSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |