Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0372700_circ_g.1 |
| ID in PlantcircBase | osa_circ_023523 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 18169980-18170121 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0372700 |
| Parent gene annotation |
Similar to Quinone-oxidoreductase QR1 (Fragment). (Os04t0372700- 01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0372700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.480886905 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18170049-18170115(-) |
| Potential amino acid sequence |
MVAASSFNSTSFFFAEGTGTSTCWDKRQSTRQQRTQHPFLNLPVNWIDGRCLQLQQHLVLLCRR DRDFNMLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |