Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G08470_circ_g.8 |
| ID in PlantcircBase | ath_circ_029965 |
| Alias | At_ciR976 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 5386209-5386463 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, circseq_cup, find_circ, CIRI-full |
| Parent gene | AT4G08470 |
| Parent gene annotation |
Mitogen-activated protein kinase kinase kinase 3 |
| Parent gene strand | - |
| Alternative splicing | 4_circ_ag.2 AT4G08470_circ_g.1 4_circ_ag.2 AT4G08470_circ_g.3 4_circ_ag.4 AT4G08470_circ_g.5 4_circ_ag.6 4_circ_ag.7 AT4G08470_circ_g.9 4_circ_ag.10 4_circ_ag.11 |
| Support reads | 6/22 |
| Tissues | leaf/leaf, aerial, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G08470.3:1 AT4G08470.2:1 AT4G08470.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.777299775 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5386430-5386211(-) |
| Potential amino acid sequence |
MTPSLEFPDRISFRKKDFSEKGPSRHVWEKRKLTRAKLIENFCNPEDIEPVTSWLKGQLLGEES FASVYEAISDSSVGSESTCSLMTPSLEFPDRISFRKKDFSEKGPSRHVWEKRKLTRAKLIENFC NPEDIEPVTSWLKGQLLGEESFASVYEAISDSSVGSESTCSLMTPSLEFPDRISFRKKDFSEKG PSRHVWEKRKLTRAKLIENFCNPEDIEPVTSWLKGQLLGEESFASVYEAISDSSVGSESTCSLM TPSLEFPDRISFRKKDFSEKGPSRHVWEKRKLTRAKLIENFCNPEDIEPVTSWLKGQLLGEESF ASVYEAIS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |