Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d027320_circ_g.3 |
| ID in PlantcircBase | zma_circ_006343 |
| Alias | zma_circ_0000566 |
| Organism | Zea mays |
| Position | chr1: 2887462-2887845 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ei-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d027320 |
| Parent gene annotation |
CemA-like proton extrusion protein-related |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d027321_T003:2 Zm00001d027321_T006:1 Zm00001d027321_T001:1 Zm00001d027321_T002:2 Zm00001d027321_T005:2 Zm00001d027321_T005:2 Zm00001d027321_T002:2 Zm00001d027321_T006:1 Zm00001d027321_T001:1 Zm00001d027320_T002:2 Zm00001d027321_T003:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.090663775 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2887509-2887554(-) 2887505-2887791(-) |
| Potential amino acid sequence |
MYGPIWFMGLFYSCLSNDVRYVQKVPLAAELLDVRRSQKLQMVKDHAFLPSHMSCSVSKVCLLL RIHLLFFHQA*(-) MVRYGLWGCSIPAYLMMSGMSRRCRLQLSYLM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |