Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d011713_circ_g.1 |
ID in PlantcircBase | zma_circ_009753 |
Alias | zma_circ_0002870 |
Organism | Zea mays |
Position | chr8: 159526845-159528727 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d011713 |
Parent gene annotation |
Myosin family protein with Dil domain |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d011713_T004:6 Zm00001d011713_T012:2 Zm00001d011713_T006:6 Zm00001d011713_T005:7 Zm00001d011713_T003:6 Zm00001d011713_T009:7 Zm00001d011713_T002:6 Zm00001d011713_T008:7 Zm00001d011713_T007:7 Zm00001d011713_T001:7 Zm00001d011713_T011:6 Zm00001d011713_T010:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.149935325 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
159528017-159528724(-) |
Potential amino acid sequence |
MKVEDANEKIGHLQTKINMLEDNVAAKDVSLEAAIKENDATRKSLTEAQERNGELLKKISDSDY RIHLLQDTVQKLQVDAISRLSSFVMEKQESDIAKRAVTEAHERNEDLLKRNEDLLKRNDDLIKK IEDSSKIVTQLQEALQRLEGKASNLEVENQVLRQHATSTPPSTAKSPASRSKISRIHRSPENGH ILNGDIRQTEMKPSTGTSAAITSVT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |