Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d011713_circ_g.1 |
| ID in PlantcircBase | zma_circ_009753 |
| Alias | zma_circ_0002870 |
| Organism | Zea mays |
| Position | chr8: 159526845-159528727 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d011713 |
| Parent gene annotation |
Myosin family protein with Dil domain |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d011713_T004:6 Zm00001d011713_T012:2 Zm00001d011713_T006:6 Zm00001d011713_T005:7 Zm00001d011713_T003:6 Zm00001d011713_T009:7 Zm00001d011713_T002:6 Zm00001d011713_T008:7 Zm00001d011713_T007:7 Zm00001d011713_T001:7 Zm00001d011713_T011:6 Zm00001d011713_T010:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149935325 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
159528017-159528724(-) |
| Potential amino acid sequence |
MKVEDANEKIGHLQTKINMLEDNVAAKDVSLEAAIKENDATRKSLTEAQERNGELLKKISDSDY RIHLLQDTVQKLQVDAISRLSSFVMEKQESDIAKRAVTEAHERNEDLLKRNEDLLKRNDDLIKK IEDSSKIVTQLQEALQRLEGKASNLEVENQVLRQHATSTPPSTAKSPASRSKISRIHRSPENGH ILNGDIRQTEMKPSTGTSAAITSVT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |