Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA033172_circ_g.6 |
ID in PlantcircBase | osi_circ_002869 |
Alias | 10:17415329|17416245 |
Organism | Oryza sativa ssp. indica |
Position | chr10: 17415329-17416245 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA033172 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA033172_circ_g.4 BGIOSGA033172_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA033172-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_007217* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17415403-17415855(-) 17415401-17415379(+) |
Potential amino acid sequence |
MCLFDKAKLRSSILQPRSLATVSAVSQRDSNSSDCPQTQPLPSQCHLQRIPLVQA*(-) MKVNNENIVQKLTLSQAIDTRDALAKSLYASLFEWLVEQINKSLSVGKRRTGRSISILDIYGFE SFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYVEDGIDWAKVEFEDNQNCLNLFEKRQKRS QDFLAAVLKISI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | leaf senescence |
Other Information | |
---|---|
References | Huang et al., 2021 |