Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA033172_circ_g.6 |
| ID in PlantcircBase | osi_circ_002869 |
| Alias | 10:17415329|17416245 |
| Organism | Oryza sativa ssp. indica |
| Position | chr10: 17415329-17416245 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA033172 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA033172_circ_g.4 BGIOSGA033172_circ_g.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA033172-TA:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_007217* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17415403-17415855(-) 17415401-17415379(+) |
| Potential amino acid sequence |
MCLFDKAKLRSSILQPRSLATVSAVSQRDSNSSDCPQTQPLPSQCHLQRIPLVQA*(-) MKVNNENIVQKLTLSQAIDTRDALAKSLYASLFEWLVEQINKSLSVGKRRTGRSISILDIYGFE SFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYVEDGIDWAKVEFEDNQNCLNLFEKRQKRS QDFLAAVLKISI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | leaf senescence |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |