Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0179400_circ_g.3 |
| ID in PlantcircBase | osa_circ_018200 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4177722-4177845 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0179400 |
| Parent gene annotation |
Drought-inducible receptor-like cytoplasmic kinase, Drought tole rance, Regulator of grain yield (Os03t0179400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0179400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.282252823 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4177804-4177774(+) 4177842-4177754(-) |
| Potential amino acid sequence |
MGTQGYAAPEYIMTGLQSQALRFRASEGRARG*(+) MMYSGAAYPCVPMTRVETCVSSSSGPSFASPKSESLALKSCHDVLWCSVSLCAHDTCRDMRLVI LWPVLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |