Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d015234_circ_g.1 |
| ID in PlantcircBase | zma_circ_008593 |
| Alias | zma_circ_0002223 |
| Organism | Zea mays |
| Position | chr5: 80286570-80288362 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d015234 |
| Parent gene annotation |
Cycloartenol synthase |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d015234_T002:5 Zm00001d015234_T009:5 Zm00001d015234_T005:4 Zm00001d015234_T011:4 Zm00001d015234_T006:4 Zm00001d015234_T004:5 Zm00001d015234_T007:4 Zm00001d015234_T008:5 Zm00001d015234_T003:4 Zm00001d015234_T010:5 Zm00001d015234_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.070768879 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
80288232-80286578(+) 80287632-80288152(-) |
| Potential amino acid sequence |
MCLESRETADCPFQCSQHSFLGHIFMLTELDAWKVKLNRVFFGELGT*(+) MFGSALTYVILRLLGEGPDSGDGAMEKGRNWILDHGGATYITSWGKFWLSVLGVFEWSGNNPVP PEVWLLPYLLPFHPGRMWCHCRMVYLPMCYIYGKRFVGRITPLLLELRKELFKDPYSKIDWDKA RNLCAKFAKENSIELHLPGIKLGEHEDVTEEAVLTTLKRAISRFSTLQAHDGHWPGDYGGPMFL MPGLVPLSTLLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |