Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d015234_circ_g.1 |
ID in PlantcircBase | zma_circ_008593 |
Alias | zma_circ_0002223 |
Organism | Zea mays |
Position | chr5: 80286570-80288362 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d015234 |
Parent gene annotation |
Cycloartenol synthase |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d015234_T002:5 Zm00001d015234_T009:5 Zm00001d015234_T005:4 Zm00001d015234_T011:4 Zm00001d015234_T006:4 Zm00001d015234_T004:5 Zm00001d015234_T007:4 Zm00001d015234_T008:5 Zm00001d015234_T003:4 Zm00001d015234_T010:5 Zm00001d015234_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.070768879 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
80288232-80286578(+) 80287632-80288152(-) |
Potential amino acid sequence |
MCLESRETADCPFQCSQHSFLGHIFMLTELDAWKVKLNRVFFGELGT*(+) MFGSALTYVILRLLGEGPDSGDGAMEKGRNWILDHGGATYITSWGKFWLSVLGVFEWSGNNPVP PEVWLLPYLLPFHPGRMWCHCRMVYLPMCYIYGKRFVGRITPLLLELRKELFKDPYSKIDWDKA RNLCAKFAKENSIELHLPGIKLGEHEDVTEEAVLTTLKRAISRFSTLQAHDGHWPGDYGGPMFL MPGLVPLSTLLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |