Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G18500_circ_g.4 |
| ID in PlantcircBase | ath_circ_003297 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 6370463-6370980 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G18500 |
| Parent gene annotation |
2-isopropylmalate synthase 1, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT1G18500_circ_g.5 AT1G18500_circ_g.6 AT1G18500_circ_g.7 AT1G18500_circ_g.8 AT1G18500_circ_g.9 AT1G18500_circ_g.10 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G18500.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.167311769 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6370487-6370977(+) |
| Potential amino acid sequence |
MEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMGAHAGARQMEVTIN GIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMGAHAGARQMEVTINGIGERA GNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMGAHAGARQMEVTINGIGERAGNASLE EVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |