Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0169800_circ_g.5 |
| ID in PlantcircBase | osa_circ_018131 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 3745704-3746086 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0169800 |
| Parent gene annotation |
HNH endonuclease domain containing protein. (Os03t0169800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GG-AC |
| Number of exons covered | Os03t0169800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.200545083 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3745748-3746062(-) 3746062-3746062(-) |
| Potential amino acid sequence |
MPLPRLRPHRPLLQDRIRGDREIMVGRKPLRRRRHDAPPSPPLFGATPRPTSPRSSSASVAAVA EELDGLLLTAPRPSASSSEPRSFPYVVKQRCWEKAERVAGRDPERWRRDALGNVVFRKLVGCPG CLCHDYDHIVPYSKIESEEIGR*(-) MVGRKPLRRRRHDAPPSPPLFGATPRPTSPRSSSASVAAVAEELDGLLLTAPRPSASSSEPRSF PYVVKQRCWEKAERVAGRDPERWRRDALGNVVFRKLVGCPGCLCHDYDHIVPYSKIESEEIGR* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |