Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0116566_circ_g.1 |
| ID in PlantcircBase | osa_circ_035641 |
| Alias | Os_ciR5643 |
| Organism | Oryza sativa |
| Position | chr8: 907614-908176 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0116566 |
| Parent gene annotation |
Hypothetical conserved gene. (Os08t0116566-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0116566-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172525548 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
907945-908168(-) 907639-908168(-) |
| Potential amino acid sequence |
MDERERQLSLHGEGVLNGFLEGLTGLLQSPIKGAEKHGLPGVISESG*(-) MVFLELSQSPVELLNGIAQGSKTLIGSTVYAVSSATSHFSKTAYKGLVAFTYDEQAASKMDERE RQLSLHGEGVLNGFLEGLTGLLQSPIKGAEKHGLPGVISESG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |