Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d007905_circ_g.2 |
ID in PlantcircBase | zma_circ_007449 |
Alias | zma_circ_0000982 |
Organism | Zea mays |
Position | chr2: 242184401-242185666 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d007905 |
Parent gene annotation |
Valine--tRNA ligase chloroplastic/mitochondrial 2 |
Parent gene strand | - |
Alternative splicing | Zm00001d007905_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d007905_T001:4 Zm00001d007905_T019:4 Zm00001d007905_T009:4 Zm00001d007905_T003:4 Zm00001d007905_T007:3 Zm00001d007905_T008:4 Zm00001d007905_T024:4 Zm00001d007905_T002:4 Zm00001d007905_T018:1 Zm00001d007905_T012:3 Zm00001d007905_T004:2 Zm00001d007905_T016:3 Zm00001d007905_T022:4 Zm00001d007905_T015:4 Zm00001d007905_T023:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.15968616 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
242185599-242184433(+) 242185563-242185635(-) 242184469-242185661(-) |
Potential amino acid sequence |
MIIVMIMSRANLQHPSSKFWINILENQVSRTSGS*(+) MNKDGTLNDVAGIYSGMDRFEAREKLWSDLVETNLAVKKEPYTLRVPRSQRGGEVIEPLISKQW FVTMEPLAEKALHAVEKGQLTILPERFEKIYNHWLTNIKDWCISRQLWWGHRIPVWYIVGKKCE EDYIVARTEEEAIAEAHEKYGKSVEIYQDPDVLDTWFSSMLIQNLELGC*(-) MKNMENQLKYIKTLMFLILGSQVC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |