Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0682900_circ_g.2 |
| ID in PlantcircBase | osa_circ_025997 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 34871859-34873129 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os04g0682900 |
| Parent gene annotation |
Similar to H0124B04.17 protein. (Os04t0682900-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0682900_circ_g.3 Os04g0682900_circ_g.4 Os04g0682900_circ_g.5 |
| Support reads | 4 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0682900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.15260436 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34872967-34871886(+) 34871917-34872044(-) |
| Potential amino acid sequence |
MRKLFHVVLQITASFSLASNKFSKFFETSGVWYLIVFLVLFTFIQLEGTFLSTGSWAINVIRAT *(+) MGGKSCYIRQVALITLMAQLPVDRKVPSSWMKVNSTKKTIRYHTPEVSKNLENLLLAKEKLAVI CRTTWNNFLMDFGRYYAQFQATVKSLATLDCLYSLATLAKQNKYVRPNFVRENEASQIHIKDGR HPVVNMKIIFYCATDTISNTTGRSHTVMHTSCEAFSLC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |