Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0605100_circ_g.3 |
ID in PlantcircBase | osa_circ_009775 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 23334538-23334687 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0605100 |
Parent gene annotation |
NB-ARC domain containing protein. (Os11t0605100-01) |
Parent gene strand | + |
Alternative splicing | Os11g0605100_circ_g.1 Os11g0605100_circ_g.2 |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0605100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.225555111 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23334576-23334684(+) |
Potential amino acid sequence |
MEQLDAPSPNSSEITMSMLEDNPELLTRNISEHLKDKRSKLVLQTILKQIMEQLDAPSPNSSEI TMSMLEDNPELLTRNISEHLKDKRSKLVLQTILKQIMEQLDAPSPNSSEITMSMLEDNPELLTR NISEHLKDKRSKLVLQTILKQIMEQLDAPSPNSSEITMSMLEDNPELLTRNISEHLKDK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |