Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G20760_circ_g.3 |
| ID in PlantcircBase | ath_circ_003664 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 7211938-7212565 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, CIRI-full |
| Parent gene | AT1G20760 |
| Parent gene annotation |
Calcium-binding EF hand family protein |
| Parent gene strand | + |
| Alternative splicing | AT1G20760_circ_g.2 AT1G20760_circ_g.4 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G20760.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12754992 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7211962-7212562(+) |
| Potential amino acid sequence |
MDSREKLDYYRTKMQDIVLYKSRCDNRLNEISERASADKREVDEKQNAYMDSREKLDYYRTKMQ DIVLYKSRCDNRLNEISERASADKREVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNRLNE ISERASADKREVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNRLNEISERASADKRE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |