Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G01330_circ_g.1 |
| ID in PlantcircBase | ath_circ_029199 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 551570-551889 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT4G01330 |
| Parent gene annotation |
Protein kinase superfamily protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G01330.1:2 AT4G01330.3:2 AT4G01330.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.166958125 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
551768-551886(+) |
| Potential amino acid sequence |
MLVYDYVDNGNLEQWIHGDVGDKSPLTWDIRMNIILCMAKGGQAEKEFRVEVEAIGRVRHKNLV RLLGYCVEGAYRMLVYDYVDNGNLEQWIHGDVGDKSPLTWDIRMNIILCMAKGGQAEKEFRVEV EAIGRVRHKNLVRLLGYCVEGAYRMLVYDYVDNGNLEQWIHGDVGDKSPLTWDIRMNIILCMAK GGQAEKEFRVEVEAIGRVRHKNLVRLLGYCVEGAYRMLVYDYVDNGNLEQWIHGDVGDKSPLTW DIRMNIILCMAK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |