Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0565500_circ_g.1 |
ID in PlantcircBase | osa_circ_040215 |
Alias | Os_ciR11948 |
Organism | Oryza sativa |
Position | chr9: 22532478-22532824 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os09g0565500 |
Parent gene annotation |
Conserved hypothetical protein. (Os09t0565500-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0565500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018778 |
PMCS | 0.14601232 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22532481-22532511(+) |
Potential amino acid sequence |
MDVRGSSQWLSSNEKVVHINRITGEAQARGEGIAEVIFKGPNTKLHTTVTVLKVNQIVVNAPAE TLTNAAGPPGGYKFSVKLRDGCAWIQSVVK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |