Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0656400_circ_g.3 |
| ID in PlantcircBase | osa_circ_031823 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 26943801-26944200 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0656500 |
| Parent gene annotation |
4-coumarate:coenzyme A ligase, Lignin biosynthesis, Defense agai nst wounding (Os06t0656500-01);Similar to cDNA clone:J023002B16, full insert sequence. (Os06t0656500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0656400-01:2 Os06t0656400-01:2 Os06t0656500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.447498542 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26943904-26944194(-) |
| Potential amino acid sequence |
MIDEIAGEVPVAFIVRIEGSAISENEIKQFVAKEVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |