Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G022400_circ_g.1 |
| ID in PlantcircBase | gra_circ_001074 |
| Alias | Chr10:1777108|1777323 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 1777108-1777323 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G022400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.010G022400.1:1 Gorai.010G022400.3:1 Gorai.010G022400.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.545523457 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1777276-1777320(+) 1777171-1777290(-) |
| Potential amino acid sequence |
MDKELHKLNRRLEEKEVLEERIAWLEATNEDLCQKLHEYRKKCNITEQCEIDSRNFDEEAAKEW EHKLLPNTMDKELHKLNRRLEEKEVLEERIAWLEATNEDLCQKLHEYRKKCNITEQCEIDSRNF DEEAAKEWEHKLLPNTMDKELHKLNRRLEEKEVLEERIAWLEATNEDLCQKLHEYRKKCNITEQ CEIDSRNFDEEAAKEWEHKLLPNTMDKELHKLNRRLEEKE(+) MKFLAKILISSFKPSNSFLENLFLLETSIQLV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |