Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0193000_circ_g.5 |
| ID in PlantcircBase | osa_circ_033110 |
| Alias | Os_ciR4995 |
| Organism | Oryza sativa |
| Position | chr7: 5026128-5026297 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0193000 |
| Parent gene annotation |
HIPL1 protein precursor. (Os07t0193000-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0193000_circ_g.3 Os07g0193000_circ_g.4 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0193000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.234874608 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5026159-5026134(+) |
| Potential amino acid sequence |
MSSPRTTPSPLTPSLRRRFSPSASRTRGGAASTPASPLTSTAPTSDSWQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |