Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0126350_circ_g.9 |
ID in PlantcircBase | osa_circ_035703 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 1527953-1528408 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os08g0126350 |
Parent gene annotation |
Hypothetical protein. (Os08t0126350-00) |
Parent gene strand | - |
Alternative splicing | Os08g0126300_circ_g.1 Os08g0126300_circ_g.2 Os08g0126300_circ_g.3 Os08g0126300_circ_g.4 Os08g0126300_circ_g.5 Os08g0126300_circ_g.6 Os08g0126300_circ_g.7 Os08g0126350_circ_g.1 Os08g0126350_circ_g.2 Os08g0126350_circ_g.3 Os08g0126350_circ_g.4 Os08g0126350_circ_g.5 Os08g0126350_circ_g.6 Os08g0126350_circ_g.7 Os08g0126350_circ_g.8 Os08g0126350_circ_g.10 Os08g0126350_circ_g.11 Os08g0126300_circ_g.12 |
Support reads | 62 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0126300-03:1 Os08t0126300-02:2 Os08t0126300-01:2 Os08t0126350-00:1 Os08t0126300-03:1 Os08t0126300-02:2 Os08t0126300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.204534247 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1527999-1527977(+) 1528364-1527972(+) 1528359-1528386(-) |
Potential amino acid sequence |
MSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRLLA RFFLI*(+) MLRKTWFLLTLLVTAGCWQGSS*(+) MIPLSFPSDADLIALLIASYEAAFSILTVRSTTETSTVGTRKDIPVSLPFKSGRTLPTACCHQQ SQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |