Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G63860_circ_g.15 |
| ID in PlantcircBase | ath_circ_045613 |
| Alias | AT5G63860_C1, AT5G63860_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 25557782-25558306 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G63860 |
| Parent gene annotation |
Ultraviolet-B receptor UVR8 |
| Parent gene strand | - |
| Alternative splicing | AT5G63860_circ_g.1 AT5G63860_circ_g.2 AT5G63860_circ_g.3 AT5G63860_circ_g.4 AT5G63860_circ_g.5 AT5G63860_circ_g.6 AT5G63860_circ_g.7 AT5G63860_circ_g.8 AT5G63860_circ_g.9 AT5G63860_circ_g.10 AT5G63860_circ_g.11 AT5G63860_circ_g.12 AT5G63860_circ_g.13 AT5G63860_circ_g.14 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G63860.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.293448443 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25557907-25558302(-) 25558144-25558302(-) |
| Potential amino acid sequence |
MVTQATCLLRYQSKHCTVFGSSRLLVGIVIVWLSLWKERSRAGDIVCSWGRGEDGQLGHGDAED RPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALH GIRIKQIACGDSHCLAVTMEGEVQSW* MEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSW* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |