Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G10120_circ_g.3 |
| ID in PlantcircBase | ath_circ_030149 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 6317122-6317253 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G10120 |
| Parent gene annotation |
Probable sucrose-phosphate synthase 4 |
| Parent gene strand | + |
| Alternative splicing | AT4G10120_circ_g.4 AT4G10120_circ_g.5 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G10120.4:1 AT4G10120.2:1 AT4G10120.1:1 AT4G10120.5:1 AT4G10120.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1710846 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6317137-6317250(+) |
| Potential amino acid sequence |
MDFSYVLTQDSQEPDGDLKSLIGPDRNQIKKPVPPIWSEVIPPGMDFSYVLTQDSQEPDGDLKS LIGPDRNQIKKPVPPIWSEVIPPGMDFSYVLTQDSQEPDGDLKSLIGPDRNQIKKPVPPIWSEV IPPGMDFSYVLTQDSQEPDGDLKSLIGPDRNQIKKPVPPIWSE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |