Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA026866_circ_g.2 |
ID in PlantcircBase | osi_circ_007783 |
Alias | 8:23997928|23998190 |
Organism | Oryza sativa ssp. indica |
Position | chr8: 23997928-23998190 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA026866 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA026866_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA026866-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_037292* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23998180-23998177(-) 23997950-23997934(+) |
Potential amino acid sequence |
MMRPLKYVRGLEFAAGVGYVDFLSRVNRVEDEARRNGSWAAPHPWLNLFISSRDIAAFDRAVLN GMLADGVDGPMLIYPMLKSKGWGR*(-) MSMGPSTPSASMPLRTARSKAAMSREEMKRLSHGCGAAQLPLRRASSSTRFTRERKSTYPTPAA NSRPRTYLSGRIISPTLWT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |