Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G12020_circ_g.10 |
| ID in PlantcircBase | ath_circ_021175 |
| Alias | At_ciR3442 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3832484-3832838 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT3G12020 |
| Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT3G12020_circ_g.11 AT3G12020_circ_g.12 AT3G12020_circ_g.13 |
| Support reads | 2/7 |
| Tissues | leaf/root, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G12020.3:2 AT3G12020.4:2 AT3G12020.2:2 AT3G12020.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.357031714 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3832496-3832835(+) |
| Potential amino acid sequence |
MSDELDLLREQKKILSEEAALQLSSLKRMSDEAAKSPQNEEINEEIKVLNDDIKAKNDQIATLE RQIMDFVMTSHEALDKSDIMQTSNKMSDELDLLREQKKILSEEAALQLSSLKRMSDEAAKSPQN EEINEEIKVLNDDIKAKNDQIATLERQIMDFVMTSHEALDKSDIMQTSNKMSDELDLLREQKKI LSEEAALQLSSLKRMSDEAAKSPQNEEINEEIKVLNDDIKAKNDQIATLERQIMDFVMTSHEAL DKSDIMQTSNKMSDELDLLREQKKILSEEAALQLSSLKRMSDEAAKSPQNEEINEEIKVLNDDI KAKNDQIATLERQIMDFVMTSHEALDKSDIMQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |