Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G12020_circ_g.10 |
ID in PlantcircBase | ath_circ_021175 |
Alias | At_ciR3442 |
Organism | Arabidpsis thaliana |
Position | chr3: 3832484-3832838 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT3G12020 |
Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
Parent gene strand | + |
Alternative splicing | AT3G12020_circ_g.11 AT3G12020_circ_g.12 AT3G12020_circ_g.13 |
Support reads | 2/7 |
Tissues | leaf/root, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G12020.3:2 AT3G12020.4:2 AT3G12020.2:2 AT3G12020.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.357031714 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3832496-3832835(+) |
Potential amino acid sequence |
MSDELDLLREQKKILSEEAALQLSSLKRMSDEAAKSPQNEEINEEIKVLNDDIKAKNDQIATLE RQIMDFVMTSHEALDKSDIMQTSNKMSDELDLLREQKKILSEEAALQLSSLKRMSDEAAKSPQN EEINEEIKVLNDDIKAKNDQIATLERQIMDFVMTSHEALDKSDIMQTSNKMSDELDLLREQKKI LSEEAALQLSSLKRMSDEAAKSPQNEEINEEIKVLNDDIKAKNDQIATLERQIMDFVMTSHEAL DKSDIMQTSNKMSDELDLLREQKKILSEEAALQLSSLKRMSDEAAKSPQNEEINEEIKVLNDDI KAKNDQIATLERQIMDFVMTSHEALDKSDIMQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |