Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0196900_circ_g.2 |
| ID in PlantcircBase | osa_circ_030080 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 4936328-4936483 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0196900 |
| Parent gene annotation |
Similar to Chaperonin. (Os06t0196900-01);Similar to 20 kDa chape ronin, chloroplast precursor (Protein Cpn21) (Chloroplast protei n Cpn10) (Chloroplast chaperonin 10) (Ch-CPN10) (Chaperonin 20). (Os06t0196900-02);Similar to Chaperonin. (Os06t0196900-03) |
| Parent gene strand | + |
| Alternative splicing | Os06g0196900_circ_g.1 Os06g0196900_circ_ag.1 Os06g0196900_circ_ag.2 Os06g0196900_circ_ag.3 |
| Support reads | 8 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0196900-03:1 Os06t0196900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.273601335 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4936452-4936480(+) 4936465-4936400(+) |
| Potential amino acid sequence |
MKPLNDRVLIKIGAEVVYSKYAGTEVQFNDTKHLILKEDDIIGVLETDDVKDMKPLNDRVLIKI GAEVVYSKYAGTEVQFNDTKHLILKEDDIIGVLETDDVKDMKPLNDRVLIKIGAEVVYSKYAGT EVQFNDTKHLILKEDDIIGVLETDDVKDMKPLNDRVLIK(+) MTGFSSRLGLKLYIQNMLGLRCNLTTPNILF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |