Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0770000_circ_g.1 |
ID in PlantcircBase | osa_circ_016702 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 32466214-32467629 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0770000 |
Parent gene annotation |
Beta 1 subunit of 20S proteasome. (Os02t0770000-01);Beta 1 subun it of 20S proteasome. (Os02t0770000-02) |
Parent gene strand | - |
Alternative splicing | Os02g0770000_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0770000-01:5 Os02t0770000-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016335 |
PMCS | 0.123388312 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32466268-32467583(-) 32467629-32467587(-) |
Potential amino acid sequence |
MDCLTTNGRRACPRKKLRNVCGKPCVGQDYSAN*(-) MYVANRASDKITQLTDNVYICRSGSAADTQVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLA YQNKNMLQAGMIVGGWDKYEGGQIFSVPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEE AEECMWQTVRRTRLLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |