Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0770000_circ_g.1 |
| ID in PlantcircBase | osa_circ_016702 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 32466214-32467629 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0770000 |
| Parent gene annotation |
Beta 1 subunit of 20S proteasome. (Os02t0770000-01);Beta 1 subun it of 20S proteasome. (Os02t0770000-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0770000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0770000-01:5 Os02t0770000-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016335 |
| PMCS | 0.123388312 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32466268-32467583(-) 32467629-32467587(-) |
| Potential amino acid sequence |
MDCLTTNGRRACPRKKLRNVCGKPCVGQDYSAN*(-) MYVANRASDKITQLTDNVYICRSGSAADTQVISDYVRYFLHQHTIQLGQPATVKVAANLIRLLA YQNKNMLQAGMIVGGWDKYEGGQIFSVPLGGTILRQPFAIGGSGSSYLYGLLDHEWKEGMSQEE AEECMWQTVRRTRLLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |