Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0455900_circ_g.2 |
| ID in PlantcircBase | osa_circ_024035 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 22807853-22809284 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0455900 |
| Parent gene annotation |
Protein of unknown function DUF1692 domain containing protein. ( Os04t0455900-01);Similar to H0523F07.5 protein. (Os04t0455900-02 ) |
| Parent gene strand | - |
| Alternative splicing | Os04g0455900_circ_g.3 Os04g0455900_circ_g.4 Os04g0455900_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0455900-01:6 Os04t0455900-02:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156684491 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22809240-22808136(+) 22808555-22809282(-) |
| Potential amino acid sequence |
MLLEHLHTSYNTAHQTPTIAQTLVKKCKNDTCCSVNVTLIGERS*(+) MQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVFFFYDLSPIKV TFTEQHVSFLHFLTNVCAIVGV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |