Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0455900_circ_g.2 |
ID in PlantcircBase | osa_circ_024035 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 22807853-22809284 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0455900 |
Parent gene annotation |
Protein of unknown function DUF1692 domain containing protein. ( Os04t0455900-01);Similar to H0523F07.5 protein. (Os04t0455900-02 ) |
Parent gene strand | - |
Alternative splicing | Os04g0455900_circ_g.3 Os04g0455900_circ_g.4 Os04g0455900_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0455900-01:6 Os04t0455900-02:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.156684491 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22809240-22808136(+) 22808555-22809282(-) |
Potential amino acid sequence |
MLLEHLHTSYNTAHQTPTIAQTLVKKCKNDTCCSVNVTLIGERS*(+) MQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVFFFYDLSPIKV TFTEQHVSFLHFLTNVCAIVGV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |