Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0345200_circ_g.2 |
ID in PlantcircBase | osa_circ_030771 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 13841326-13841640 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os06g0345200 |
Parent gene annotation |
Similar to Nicotianamine aminotransferase. (Os06t0345200-01);Sim ilar to Nicotianamine aminotransferase. (Os06t0345200-02) |
Parent gene strand | + |
Alternative splicing | Os06g0345200_circ_g.1 |
Support reads | 2 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0345200-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016162 |
PMCS | 0.305669762 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13841345-13841357(+) 13841342-13841476(-) |
Potential amino acid sequence |
MKNTNDEFFRKTLELLKETAEICFGEIKEIKCITCPHKPEGSFFMMVKLDISQLSDICDDIDFC SKLVKEESVVLLPGSYSSYYEEHK*(+) MRNSSQAKVRQTPPLPTCCRNRCRHKCPIIVIYQVLPS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |