Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0345200_circ_g.2 |
| ID in PlantcircBase | osa_circ_030771 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 13841326-13841640 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0345200 |
| Parent gene annotation |
Similar to Nicotianamine aminotransferase. (Os06t0345200-01);Sim ilar to Nicotianamine aminotransferase. (Os06t0345200-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0345200_circ_g.1 |
| Support reads | 2 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0345200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016162 |
| PMCS | 0.305669762 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13841345-13841357(+) 13841342-13841476(-) |
| Potential amino acid sequence |
MKNTNDEFFRKTLELLKETAEICFGEIKEIKCITCPHKPEGSFFMMVKLDISQLSDICDDIDFC SKLVKEESVVLLPGSYSSYYEEHK*(+) MRNSSQAKVRQTPPLPTCCRNRCRHKCPIIVIYQVLPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |