Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d006717_circ_g.1 |
| ID in PlantcircBase | zma_circ_007379 |
| Alias | zma_circ_0000922 |
| Organism | Zea mays |
| Position | chr2: 215057220-215057970 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d006717 |
| Parent gene annotation |
SUMO-activating enzyme subunit 2 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d006717_T005:2 Zm00001d006717_T004:2 Zm00001d006717_T010:2 Zm00001d006717_T007:2 Zm00001d006717_T001:2 Zm00001d006717_T009:2 Zm00001d006717_T002:2 Zm00001d006717_T008:2 Zm00001d006717_T006:2 Zm00001d006717_T003:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.291410939 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
215057560-215057352(+) |
| Potential amino acid sequence |
MVSLGLRNTQEIWSLADNSRVFLEALKLFFDKREKEIGSLIFDKDDQLAVEFVTAAANIRASSF GIPLHSLFEAKGVAGNIVHAVATTNAIIAGLIVIEAIKVLKGDYQDYSLFIALFGRKICFLQNY LVIKNRIMILMCTPKMIPVQKQMFLKGV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |