Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0596900_circ_g.1 |
ID in PlantcircBase | osa_circ_015296 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 23180532-23180651 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os02g0596900 |
Parent gene annotation |
Actin/actin-like family protein. (Os02t0596900-01) |
Parent gene strand | + |
Alternative splicing | Os02g0596900_circ_g.2 Os02g0596900_circ_g.3 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0596900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.429169444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23180625-23180534(-) |
Potential amino acid sequence |
MSQVYLAPVFGLMPLQCFMYLLGSLSCLLNSSGPRKRSYPMSQVYLAPVFGLMPLQCFMYLLGS LSCLLNSSGPRKRSYPMSQVYLAPVFGLMPLQCFMYLLGSLSCLLNSSGPRKRSYPMSQVYLAP VFGLMPLQCFMYLLGSLSCLLN(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |