Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0121700_circ_g.6 |
| ID in PlantcircBase | osa_circ_026370 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 1188722-1189147 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0121700 |
| Parent gene annotation |
DNA repair and recombination, RecA-like domain containing protei n. (Os05t0121700-01);DNA repair and recombination, RecA-like dom ain containing protein. (Os05t0121700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0121700-01:3 Os05t0121700-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133019797 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1188742-1188738(+) 1188959-1189140(-) |
| Potential amino acid sequence |
MMLGAGLGSSQPSFGPSLLDEIFEESFSHQSRSSSVKRIWIQYQYTKLDHLSLHSILVMLLAKQ ASDRTLGKFR*(+) MIEIGEKSFPQIFRQEGLAQKMAGRILVLRPTSLSEFTKSSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |