Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G30210_circ_g.18 |
ID in PlantcircBase | ath_circ_033635 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 14800295-14800408 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G30210 |
Parent gene annotation |
P450 reductase 2 |
Parent gene strand | + |
Alternative splicing | AT4G30210_circ_g.12 AT4G30210_circ_g.13 AT4G30210_circ_g.14 AT4G30210_circ_g.15 AT4G30210_circ_g.16 AT4G30210_circ_g.17 |
Support reads | 10 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G30210.3:1 AT4G30210.2:1 AT4G30210.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.409815384 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14800313-14800405(+) |
Potential amino acid sequence |
MISQGAYLYVCGDAKGMARDVHRSLHTIAQEQASDIWNMISQGAYLYVCGDAKGMARDVHRSLH TIAQEQASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQASDIWNMISQGAYLYVCGDA KGMARDVHRSLHTIAQEQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |