Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G30210_circ_g.18 |
| ID in PlantcircBase | ath_circ_033635 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 14800295-14800408 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G30210 |
| Parent gene annotation |
P450 reductase 2 |
| Parent gene strand | + |
| Alternative splicing | AT4G30210_circ_g.12 AT4G30210_circ_g.13 AT4G30210_circ_g.14 AT4G30210_circ_g.15 AT4G30210_circ_g.16 AT4G30210_circ_g.17 |
| Support reads | 10 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G30210.3:1 AT4G30210.2:1 AT4G30210.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.409815384 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14800313-14800405(+) |
| Potential amino acid sequence |
MISQGAYLYVCGDAKGMARDVHRSLHTIAQEQASDIWNMISQGAYLYVCGDAKGMARDVHRSLH TIAQEQASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQASDIWNMISQGAYLYVCGDA KGMARDVHRSLHTIAQEQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |