Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0566800_circ_g.1 |
ID in PlantcircBase | osa_circ_015086 |
Alias | Os_ciR7817 |
Organism | Oryza sativa |
Position | chr2: 21550829-21551127 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0566800 |
Parent gene annotation |
Similar to Avr9 elicitor response protein. (Os02t0566800-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0566800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011883 |
PMCS | 0.78542064 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21551068-21550836(+) 21550942-21551099(-) 21551127-21551099(-) |
Potential amino acid sequence |
MHPIYVLGFDLCRARVVASILVD*(+) MNLSTGNLGRKGTNTSVMLLGRYTRFQKTSRPTFQSTRMLATTLARHKSKPRTYIGCMKSGPVL ADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQNACHYPCSA*(-) MLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLA TYISINQNACHYPCSA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |