Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0566800_circ_g.1 |
| ID in PlantcircBase | osa_circ_015086 |
| Alias | Os_ciR7817 |
| Organism | Oryza sativa |
| Position | chr2: 21550829-21551127 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0566800 |
| Parent gene annotation |
Similar to Avr9 elicitor response protein. (Os02t0566800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0566800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011883 |
| PMCS | 0.78542064 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21551068-21550836(+) 21550942-21551099(-) 21551127-21551099(-) |
| Potential amino acid sequence |
MHPIYVLGFDLCRARVVASILVD*(+) MNLSTGNLGRKGTNTSVMLLGRYTRFQKTSRPTFQSTRMLATTLARHKSKPRTYIGCMKSGPVL ADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISINQNACHYPCSA*(-) MLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLA TYISINQNACHYPCSA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |