Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G016000_circ_g.3 |
| ID in PlantcircBase | gra_circ_000012 |
| Alias | Chr01:1500614|1501211 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 1500614-1501211 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G016000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.001G016000_circ_g.1 orai.001G016000_circ_g.2 |
| Support reads | 3/3 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G016000.8:3 Gorai.001G016000.3:2 Gorai.001G016000.1:3 Gorai.001G016000.6:3 Gorai.001G016000.4:3 Gorai.001G016000.5:3 Gorai.001G016000.2:3 Gorai.001G016000.7:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000005* |
| PMCS | 0.101036441 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1500979-1500616(+) |
| Potential amino acid sequence |
MDLKIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |