Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0736600_circ_g.3 |
| ID in PlantcircBase | osa_circ_016442 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30758333-30758563 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0736600 |
| Parent gene annotation |
DEAD-like helicase, N-terminal domain containing protein. (Os02t 0736600-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0736600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004258* |
| PMCS | 0.623483478 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30758502-30758560(+) |
| Potential amino acid sequence |
MVGSKCSIKFMTDGILLREVQFLYEAGFGTSNRSDRKGIIGITQPRRVAVLATARRVSYELGLK LGKEVGFQVRHDKMVGSKCSIKFMTDGILLREVQFLYEAGFGTSNRSDRKGIIGITQPRRVAVL ATARRVSYELGLKLGKEVGFQVRHDKMVGSKCSIKFMTDGILLREVQFLYEAGFGTSNRSDRKG IIGITQPRRVAVLATARRVSYELGLKLGKEVGFQVRHDKMVGSKCSIKFMTDGILLREVQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |