Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G54490_circ_g.10 |
| ID in PlantcircBase | ath_circ_007394 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 20353438-20353737 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G54490 |
| Parent gene annotation |
XRN4 |
| Parent gene strand | + |
| Alternative splicing | AT1G54490_circ_g.1 AT1G54490_circ_g.2 AT1G54490_circ_g.3 AT1G54490_circ_g.4 AT1G54490_circ_g.5 AT1G54490_circ_g.6 AT1G54490_circ_g.7 AT1G54490_circ_g.8 AT1G54490_circ_g.9 AT1G54490_circ_g.11 AT1G54490_circ_g.12 AT1G54490_circ_g.13 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G54490.1:2 AT1G54490.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.200526361 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20353441-20353734(+) |
| Potential amino acid sequence |
MDNNEEMKQRSRRDPSEVPPEPIDDKIKLGEPGYKERYYAEKFSTTNPEETEQIKQDMSMDNNE EMKQRSRRDPSEVPPEPIDDKIKLGEPGYKERYYAEKFSTTNPEETEQIKQDMSMDNNEEMKQR SRRDPSEVPPEPIDDKIKLGEPGYKERYYAEKFSTTNPEETEQIKQDMSMDNNEEMKQRSRRDP SEVPPEPIDDKIKLGEPGYKERYYAEKFSTTNPEETEQIKQDM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |