Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G13540_circ_g.3 |
| ID in PlantcircBase | ath_circ_013248 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 5639051-5639496 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | AT2G13540 |
| Parent gene annotation |
Nuclear cap-binding protein subunit 1 |
| Parent gene strand | + |
| Alternative splicing | AT2G13540_circ_g.1 AT2G13540_circ_g.2 AT2G13540_circ_g.4 AT2G13540_circ_g.5 AT2G13540_circ_g.6 AT2G13540_circ_g.7 AT2G13540_circ_g.8 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G13540.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.15453679 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5639371-5639493(+) |
| Potential amino acid sequence |
MEQPSPPSDHSRAYSGKQKHDALTRYPQRIRRLNIFPANKMEDFVEDLLDRIQSLASNGWKLES VPRPHLSFEAQLVAGKFHELRPIKCMEQPSPPSDHSRAYSGKQKHDALTRYPQRIRRLNIFPAN KMEDFVEDLLDRIQSLASNGWKLESVPRPHLSFEAQLVAGKFHELRPIKCMEQPSPPSDHSRAY SGKQKHDALTRYPQRIRRLNIFPANKMEDFVEDLLDRIQSLASNGWKLESVPRPHLSFEAQLVA GKFHELRPIKCMEQPSPPSDHSRAYSGKQKHDALTRYPQRIRRLNIFPANKME(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |