Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0506200_circ_g.2 |
| ID in PlantcircBase | osa_circ_001865 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 17615968-17622964 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0506200 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os01t 0506200-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0506200_circ_g.1 Os01g0506200_circ_g.3 Os01g0506200_circ_g.4 Os01g0506200_circ_g.5 Os01g0506200_circ_g.6 Os01g0506200_circ_g.7 Os01g0506200_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0506200-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009537 |
| PMCS | 0.093399048 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17622896-17615999(+) 17622907-17622943(-) |
| Potential amino acid sequence |
MSSITASFACLMLSSTSCAWPSLLLHSVDHRLRV*(+) MLDIRDGNSWYNLGNAYLTSFFVSGSWDHMKLHHSVKAYQNAEKDETTKCNPDLYYNCATADKY LENYERALRGFEAAALKDPGLGADTEVQKIISLLDKLDSAMKGQLRSKRLASSVSSLSEVNIKS SHKKATIGILSEGLNKTVAVLGKVILLIRHDNIAPMYYLTCDLDQSYFILSVYGLRNEAVVKAK HS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |