Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0506200_circ_g.2 |
ID in PlantcircBase | osa_circ_001865 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 17615968-17622964 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0506200 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os01t 0506200-01) |
Parent gene strand | - |
Alternative splicing | Os01g0506200_circ_g.1 Os01g0506200_circ_g.3 Os01g0506200_circ_g.4 Os01g0506200_circ_g.5 Os01g0506200_circ_g.6 Os01g0506200_circ_g.7 Os01g0506200_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0506200-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009537 |
PMCS | 0.093399048 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17622896-17615999(+) 17622907-17622943(-) |
Potential amino acid sequence |
MSSITASFACLMLSSTSCAWPSLLLHSVDHRLRV*(+) MLDIRDGNSWYNLGNAYLTSFFVSGSWDHMKLHHSVKAYQNAEKDETTKCNPDLYYNCATADKY LENYERALRGFEAAALKDPGLGADTEVQKIISLLDKLDSAMKGQLRSKRLASSVSSLSEVNIKS SHKKATIGILSEGLNKTVAVLGKVILLIRHDNIAPMYYLTCDLDQSYFILSVYGLRNEAVVKAK HS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |