Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0353900_circ_g.1 |
ID in PlantcircBase | osa_circ_019861 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 13321188-13322462 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0353900 |
Parent gene annotation |
Argonaute and Dicer protein, PAZ domain containing protein. (Os0 3t0353900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0353900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.102624294 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13321622-13321247(+) 13321280-13322433(-) |
Potential amino acid sequence |
MSAASFMPVRIIQIIDGFLNISYTSRPLLERNRVQLKKVLCHVCIETNHHDDQIGRYKITGITP IPMSNNICPVGEEGTTMTVLQYFCDMEKTGVPSVGHWNIAEESCHRAQILSLYSDWSPGLHW*( +) MVTSPRVKSITNVTLVTNLSTKKGSGPCDMTLQRCSNVQH*(-) |
Sponge-miRNAs | osa-miR1437b-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |