Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G14147_circ_g.1 |
ID in PlantcircBase | ath_circ_030835 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 8154502-8154591 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G14147 |
Parent gene annotation |
Actin-related protein 2/3 complex subunit 4 |
Parent gene strand | - |
Alternative splicing | AT4G14147_circ_g.2 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-GC |
Number of exons covered | AT4G14147.3:1 AT4G14147.1:1 AT4G14147.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.257406478 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8154547-8154504(-) |
Potential amino acid sequence |
MQKQKLIDFIIQFMEGYDISFLITNYHCEEMQKQKLIDFIIQFMEGYDISFLITNYHCEEMQKQ KLIDFIIQFMEGYDISFLITNYHCEEMQKQKLIDFIIQFME(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |