Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d044506_circ_g.1 |
| ID in PlantcircBase | zma_circ_007916 |
| Alias | zma_circ_0001394, GRMZM2G030596_C1 |
| Organism | Zea mays |
| Position | chr3: 230173753-230175626 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d044506 |
| Parent gene annotation |
Protein MICRORCHIDIA 6 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d044506_T006:5 Zm00001d044506_T002:5 Zm00001d044506_T009:5 Zm00001d044506_T001:5 Zm00001d044506_T013:5 Zm00001d044506_T012:5 Zm00001d044506_T005:5 Zm00001d044506_T003:5 Zm00001d044506_T008:5 Zm00001d044506_T007:5 Zm00001d044506_T011:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.048640084 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
230174039-230173783(+) 230173765-230175544(-) |
| Potential amino acid sequence |
MYRECVLYKPQIAGLTESSVITTIGFVKGAPDIDVQGFNVYHKNRLILPFWKVANNSYGKGRGV VGILEANFIKPTHDKQDFEKSVLYQRLEFRLKEMTYEYWISSLLGPTRR*(+) MRISSIRKSFLSSGTQVFDKGLTSQNPACHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |