Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d044506_circ_g.1 |
ID in PlantcircBase | zma_circ_007916 |
Alias | zma_circ_0001394, GRMZM2G030596_C1 |
Organism | Zea mays |
Position | chr3: 230173753-230175626 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d044506 |
Parent gene annotation |
Protein MICRORCHIDIA 6 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d044506_T006:5 Zm00001d044506_T002:5 Zm00001d044506_T009:5 Zm00001d044506_T001:5 Zm00001d044506_T013:5 Zm00001d044506_T012:5 Zm00001d044506_T005:5 Zm00001d044506_T003:5 Zm00001d044506_T008:5 Zm00001d044506_T007:5 Zm00001d044506_T011:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.048640084 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
230174039-230173783(+) 230173765-230175544(-) |
Potential amino acid sequence |
MYRECVLYKPQIAGLTESSVITTIGFVKGAPDIDVQGFNVYHKNRLILPFWKVANNSYGKGRGV VGILEANFIKPTHDKQDFEKSVLYQRLEFRLKEMTYEYWISSLLGPTRR*(+) MRISSIRKSFLSSGTQVFDKGLTSQNPACHG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |