Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d032099_circ_g.2 |
ID in PlantcircBase | zma_circ_006762 |
Alias | zma_circ_0000387 |
Organism | Zea mays |
Position | chr1: 212684160-212685481 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d032099 |
Parent gene annotation |
sec34-like family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d032099_circ_g.1 Zm00001d032099_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d032099_T002:4 Zm00001d032099_T001:4 Zm00001d032099_T005:4 Zm00001d032099_T004:4 Zm00001d032099_T006:4 Zm00001d032099_T003:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.047083012 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
212685077-212685474(-) |
Potential amino acid sequence |
MSITKLVVDPMLSFVTKVTAVKVALSSGSQGQKLDSVLAKPLKTQAFASPDKVAELVQKVAAAI QQDLPKVMTKMRLYLQNPSTRMILFKPIKIT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |