Detail information of AT3G23870_circ_g.2


General Information
CircRNA Name AT3G23870_circ_g.2
ID in PlantcircBase ath_circ_023488
Alias Ath_circ_FC1280
Organism Arabidpsis thaliana
Position chr3: 8621368-8621460  JBrowse»
Reference genome TAIR10.38
Type   e-circRNA
Identification method PcircRNA_finder, CIRI-full
Parent gene AT3G23870
Parent gene annotation Probable magnesium transporter NIPA1
Parent gene strand +
Alternative splicing AT3G23870_circ_g.1
Support reads 2
Tissues leaf
Exon boundary   Yes-Yes
Splicing signals   GT-AG
Number of exons covered AT3G23870.3:1
AT3G23870.2:1
AT3G23870.1:1
AT3G23870.4:1
AT3G23870.5:1
Experimental Information
Sanger sequencing for BSS   NA
PCR primers for BSS    NA
Sanger sequencing for FL    NA
PCR primers for FL    NA
Sequences
Splice junction sequence   TATGTTCACAACATTCACAATCATAGCTAGTATGATCATGTTCAAGgcattggatacattcaac
acagcggttatttctccggtttactacgt
Assembled circRNA sequence   Yes
Full-length trsnacripts Transcript length: 93
Transcript exons: 8621368-8621460
GCATTGGATACATTCAACACAGCGGTTATTTCTCCGGTTTACTACGTTATGTTCACAACATTCA
CAATCATAGCTAGTATGATCATGTTCAAG

Genomic sequence GCATTGGATACATTCAACACAGCGGTTATTTCTCCGGTTTACTACGTTATGTTCACAACATTCA
CAATCATAGCTAGTATGATCATGTTCAAG
Conservation Information
Conserved circRNAs NA
PMCS 0.216846774
Functional Information
Coding potential Y
Potential coding position 8621416-8621457(+)
Potential amino acid sequence MFTTFTIIASMIMFKALDTFNTAVISPVYYVMFTTFTIIASMIMFKALDTFNTAVISPVYYVMF
TTFTIIASMIMFKALDTFNTAVISPVYYVMFTTFTIIASMIMFK(+)
Sponge-miRNAs NA
circRNA-miRNA-mRNA network  VISUALIZATION
Potential function description NA
Other Information
References Chu et al., 2017;Chen et al., 2017a