Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0926200_circ_g.1 |
| ID in PlantcircBase | osa_circ_005609 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 40608698-40609967 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0926200 |
| Parent gene annotation |
Similar to RING-H2 finger protein RHF1a (Fragment). (Os01t092620 0-01);Similar to RING-H2 finger protein RHF1a (Fragment). (Os01t 0926200-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0926200-02:3 Os01t0926200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.17369145 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40608759-40609753(-) |
| Potential amino acid sequence |
MSVLLEIVSAEATAKSSHGSLPTNRTSITSFHPFVDTTKMIMMGAFSYNLRIVWSVFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |