Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0926200_circ_g.1 |
ID in PlantcircBase | osa_circ_005609 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 40608698-40609967 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0926200 |
Parent gene annotation |
Similar to RING-H2 finger protein RHF1a (Fragment). (Os01t092620 0-01);Similar to RING-H2 finger protein RHF1a (Fragment). (Os01t 0926200-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0926200-02:3 Os01t0926200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.17369145 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40608759-40609753(-) |
Potential amino acid sequence |
MSVLLEIVSAEATAKSSHGSLPTNRTSITSFHPFVDTTKMIMMGAFSYNLRIVWSVFF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |