Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G244300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000879 |
| Alias | Chr08:52962878|52963224 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 52962878-52963224 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G244300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.008G244300.1:2 Gorai.008G244300.2:2 Gorai.008G244300.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.711138953 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
52963118-52963115(+) 52963152-52962894(+) 52962926-52963206(-) |
| Potential amino acid sequence |
MSSLLFSALHWHASLVLLSAAVFHVLLQSYMLWQISGVAKHLESTNTMLSFIWWIVGFYWVSIG GQALARTSPQLYWLALYNFSRF*(+) MHHWYCCLLLSSMYYCNPICCGRSAVLQSI*(+) MNDNIVFVDSRCFATPLICHSI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |